PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00568.1.g00130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 546aa    MW: 58351.7 Da    PI: 10.0667
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00568.1.g00130.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.86e-19225270147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   +g+W++eEde l ++v+++G ++W++I+r ++ gR++k+c++rw + 
  Zmw_sc00568.1.g00130.1.am.mk 225 KGPWSPEEDEALQRLVARHGARNWSLISRSIP-GRSGKSCRLRWCNQ 270
                                   79******************************.***********985 PP

2Myb_DNA-binding54.42.8e-17279321347
                                   SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   ++T+eEde +++a++++G++ W+tIar +  gRt++ +k++w++ 
  Zmw_sc00568.1.g00130.1.am.mk 279 PFTPEEDETILRAHARFGNK-WATIARLLS-GRTDNAIKNHWNST 321
                                   89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.597220275IPR017930Myb domain
SuperFamilySSF466898.99E-32222318IPR009057Homeodomain-like
SMARTSM007178.3E-17224273IPR001005SANT/Myb domain
PfamPF002494.2E-18225270IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-26226278IPR009057Homeodomain-like
CDDcd001671.90E-15227269No hitNo description
SMARTSM007177.1E-15276324IPR001005SANT/Myb domain
PROSITE profilePS5129420.809277326IPR017930Myb domain
CDDcd001671.26E-11279322No hitNo description
Gene3DG3DSA:1.10.10.601.7E-23279325IPR009057Homeodomain-like
PfamPF002491.7E-14279321IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MCLTAHLSPA CPALGLIRSV FVVNDPRAAW LRRVGGQKLH PWIGKETRPA AAAGVVGRGS  60
ERTAFSPASP SADPVDSTNV TNGFVAGRER ERDGDSERDA ATDGTRRVPP SRTHAHAFLH  120
PPPPRRSVRS SSSLSASALI YAASPSELDF TSLYPPRADG SSSFPPSSFL LPTFSSNLSI  180
QQQLAPSHHK PPQIYSDCYP RPEPPEIMAS PSCRGGSSKD VDRIKGPWSP EEDEALQRLV  240
ARHGARNWSL ISRSIPGRSG KSCRLRWCNQ LSPQVEHRPF TPEEDETILR AHARFGNKWA  300
TIARLLSGRT DNAIKNHWNS TLKRKYYASA SGVAAGGASV DLAAVAPVDE EEMRRPLKRT  360
SSDGHPGLSF SPGSPSGSDV SDSSHHSLPS VMPSSSAAPA PTSSQQQHVY RPVPRAGGVV  420
VLPASMAPRP PSPPPPQQPP PQAPATSLSL SLSPPGLDRP DPSPSLSPAA PPPAHMPQPA  480
SLPFQLHPPA PKPPAPAPFS SEFLSMMKEM IRIEVRNYMS GSGLEPRSGA DVHAATQRMM  540
GMAKIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-382223254107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00274DAPTransfer from AT2G23290Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001151336.11e-138sucrose responsive element binding protein
SwissprotQ9FDW13e-78MYB44_ARATH; Transcription factor MYB44
TrEMBLB6TZ851e-138B6TZ85_MAIZE; Sucrose responsive element binding protein
STRINGGRMZM2G050550_P011e-137(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154